(data stored in ACNUC30630 zone)

EMBL: CP001275.CARA

CP001275.CARA        Location/Qualifiers
FT   CDS             complement(222754..223905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="trd_0213"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04539"
FT                   /db_xref="GOA:B9KXM6"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM6"
FT                   /protein_id="ACM04539.1"
FT                   /translation="MSIQRSRIGALVLEDGRIFPGTPFGARRPAEGEAVFTTVMTGYQE
FT                   VVTDPSFYGQLVCMTYPLIGNYGVCDEDEQSRRPWAAGLIVREYCDRPSHWKARETLAS
FT                   YLERWGIPGLAHVDTRALTRHLRTHGTMRAILVPDRTGLTDAELVAWAQRAWTPDREDV
FT                   VPAVRGEPATFGPADAPHIVLIDCGVKRNIIASLLRRAVRLTVLPYGVDAATVLALEPD
FT                   GIVVSPGPGDPTRATDAIETVRVLATSGIPFFGICLGHQLLALAAGARTIKLTFGHRGG
FT                   NHPVKEIPTGRVRITSQNHGYCVAHDSIPEQDGWQVWMINVNDGTVEGLRHRSLPVLTV
FT                   QFHPEGSPGPQDSQDLFDAFVELVQQRWRARTARPIVLAGEGA"
     MSIQRSRIGA LVLEDGRIFP GTPFGARRPA EGEAVFTTVM TGYQEVVTDP SFYGQLVCMT        60
     YPLIGNYGVC DEDEQSRRPW AAGLIVREYC DRPSHWKARE TLASYLERWG IPGLAHVDTR       120
     ALTRHLRTHG TMRAILVPDR TGLTDAELVA WAQRAWTPDR EDVVPAVRGE PATFGPADAP       180
     HIVLIDCGVK RNIIASLLRR AVRLTVLPYG VDAATVLALE PDGIVVSPGP GDPTRATDAI       240
     ETVRVLATSG IPFFGICLGH QLLALAAGAR TIKLTFGHRG GNHPVKEIPT GRVRITSQNH       300
     GYCVAHDSIP EQDGWQVWMI NVNDGTVEGL RHRSLPVLTV QFHPEGSPGP QDSQDLFDAF       360
     VELVQQRWRA RTARPIVLAG EGA                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page