(data stored in ACNUC30630 zone)

EMBL: CP001275.CAS1

CP001275.CAS1        Location/Qualifiers
FT   CDS             24072..25061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="trd_0022"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="identified by match to protein family HMM PF01867;
FT                   match to protein family HMM TIGR00287; match to protein
FT                   family HMM TIGR03641"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05097"
FT                   /db_xref="GOA:B9L1C1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C1"
FT                   /protein_id="ACM05097.1"
FT                   /translation="MTKPIYVFSSGRLARHQNTIVLETEEGKRFLPVEQVSELYVFGEV
FT                   DLNKRFLEFIAREGVLLHFFNRYGFYTGTFYPREYLSSGALILRQVEHYLDQAKRLTLA
FT                   RAFVHGALRNIRTVLLYYRRRGVDVQAAVEIIERARAGIEEAGTTAELMALEGQAREAY
FT                   YAVWPAIIEAEFPFGPRTRRPPRDETNALISFGNSLLYTAVLAQIYQTHLDPRIGYLHE
FT                   TNFRRHTLNLDVAEIFKPVLVDRLIFRLVNRGQLQRRHFVTGAEGVFLDDDGRKLVVEA
FT                   WEQTLQETYRHPSLNRSVSYRTTLRLELYKLEKHLLGEQAYVPFALRG"
     MTKPIYVFSS GRLARHQNTI VLETEEGKRF LPVEQVSELY VFGEVDLNKR FLEFIAREGV        60
     LLHFFNRYGF YTGTFYPREY LSSGALILRQ VEHYLDQAKR LTLARAFVHG ALRNIRTVLL       120
     YYRRRGVDVQ AAVEIIERAR AGIEEAGTTA ELMALEGQAR EAYYAVWPAI IEAEFPFGPR       180
     TRRPPRDETN ALISFGNSLL YTAVLAQIYQ THLDPRIGYL HETNFRRHTL NLDVAEIFKP       240
     VLVDRLIFRL VNRGQLQRRH FVTGAEGVFL DDDGRKLVVE AWEQTLQETY RHPSLNRSVS       300
     YRTTLRLELY KLEKHLLGEQ AYVPFALRG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page