(data stored in ACNUC30630 zone)

EMBL: CP001275.CAS4

CP001275.CAS4        Location/Qualifiers
FT   CDS             23488..24075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas4"
FT                   /locus_tag="trd_0021"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="identified by match to protein family HMM PF01930;
FT                   match to protein family HMM TIGR00372"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05786"
FT                   /db_xref="GOA:B9L1C0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C0"
FT                   /protein_id="ACM05786.1"
FT                   /translation="MDQIVTGTLMSYVGICDRKIWLAGHAIEGYRDHELLALGRLLAES
FT                   AYPRERKELALPGMKVDVLRRRPADADEDEALVIGEVKRSPRAQHAQRLQLGYYLLRLR
FT                   EAGLHVRGELRYPEQRRVEPVELTPELEQAVRSAIARVEELLAQPQPPPPVRIAACANC
FT                   AYFEFCWVSEEPATADSPRRRTRSAASADGKR"
     MDQIVTGTLM SYVGICDRKI WLAGHAIEGY RDHELLALGR LLAESAYPRE RKELALPGMK        60
     VDVLRRRPAD ADEDEALVIG EVKRSPRAQH AQRLQLGYYL LRLREAGLHV RGELRYPEQR       120
     RVEPVELTPE LEQAVRSAIA RVEELLAQPQ PPPPVRIAAC ANCAYFEFCW VSEEPATADS       180
     PRRRTRSAAS ADGKR                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page