(data stored in ACNUC30630 zone)

EMBL: CP001275.CAS5T

CP001275.CAS5T       Location/Qualifiers
FT   CDS             20455..21162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas5t"
FT                   /locus_tag="trd_0019"
FT                   /product="CRISPR-associated protein Cas5, Tneap subtype"
FT                   /note="identified by match to protein family HMM TIGR01895;
FT                   match to protein family HMM TIGR02593"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05122"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B8"
FT                   /protein_id="ACM05122.1"
FT                   /translation="MLDGAVRIRLTALTASFRAPSFVAYQLSLAVPPLATIFGLLSAAR
FT                   GHWVMPHEVPWLAYRLTYAARAMDLEAIYSVERKDAADTPRFKERNIVQREFLVSPELD
FT                   LFLPAEWRDPFLRPRYQLVLGRSQDLATVSSIGPASLEPVSTGPVTGVLLPAEVVARNG
FT                   VTAVLQNLPVAFTPDPERAPVRVTMFGLIDGKRSTRGLQFVTIEDGAGWLVRDRESGVV
FT                   VPLYRQEWILDGR"
     MLDGAVRIRL TALTASFRAP SFVAYQLSLA VPPLATIFGL LSAARGHWVM PHEVPWLAYR        60
     LTYAARAMDL EAIYSVERKD AADTPRFKER NIVQREFLVS PELDLFLPAE WRDPFLRPRY       120
     QLVLGRSQDL ATVSSIGPAS LEPVSTGPVT GVLLPAEVVA RNGVTAVLQN LPVAFTPDPE       180
     RAPVRVTMFG LIDGKRSTRG LQFVTIEDGA GWLVRDRESG VVVPLYRQEW ILDGR            235
//

If you have problems or comments...

PBIL Back to PBIL home page