(data stored in ACNUC30630 zone)

EMBL: CP001275.DAPB

CP001275.DAPB        Location/Qualifiers
FT   CDS             complement(412021..412797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="trd_0413"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF05173; match to protein
FT                   family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06161"
FT                   /db_xref="GOA:B9KY70"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KY70"
FT                   /protein_id="ACM06161.1"
FT                   /translation="MLRLALTGVTGRMGRAVLELAASAPDIQLVCGLIRPARDPHEVAA
FT                   QLPAPLALTSRVAELVQGADVVVDFSHPAVTVAVAEAAAHAGIPLVSGTTGLSEHDQAV
FT                   ILRAAQHVPVVQAANFSLGIALLHWLLPELVARLPTWDVELIERHHRHKRDAPSGTALA
FT                   LARTLLAAREPAPSPLVYGRGPGTAPRQPGEVGIHAVRAGGEVGRHTVLLATDDEAIEV
FT                   THWVQSRRAYAQGALEAARRLIGRPPGLYSLQDLVT"
     MLRLALTGVT GRMGRAVLEL AASAPDIQLV CGLIRPARDP HEVAAQLPAP LALTSRVAEL        60
     VQGADVVVDF SHPAVTVAVA EAAAHAGIPL VSGTTGLSEH DQAVILRAAQ HVPVVQAANF       120
     SLGIALLHWL LPELVARLPT WDVELIERHH RHKRDAPSGT ALALARTLLA AREPAPSPLV       180
     YGRGPGTAPR QPGEVGIHAV RAGGEVGRHT VLLATDDEAI EVTHWVQSRR AYAQGALEAA       240
     RRLIGRPPGL YSLQDLVT                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page