(data stored in ACNUC30630 zone)

EMBL: CP001275.DCD

CP001275.DCD         Location/Qualifiers
FT   CDS             539928..540521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="trd_0546"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR02274"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04845"
FT                   /db_xref="GOA:B9KYK0"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYK0"
FT                   /protein_id="ACM04845.1"
FT                   /translation="MILSDRDIIAALKSGRIKITPEPDLETQLGACSIDLHLGNTFMVF
FT                   EHSRFSYIDPRQPQSIGDAMRTIVVPDGEPFIMQAGDFALASTREYIELADDLVGRLEG
FT                   RSSIARLGITVHSTAALFEPGWAGTATMELSNLGRMAVALYPGMRICSFTFEQLSSPAM
FT                   VPYRMKRGNKYAGQKDPKPSRLAEELSLEQLRGR"
     MILSDRDIIA ALKSGRIKIT PEPDLETQLG ACSIDLHLGN TFMVFEHSRF SYIDPRQPQS        60
     IGDAMRTIVV PDGEPFIMQA GDFALASTRE YIELADDLVG RLEGRSSIAR LGITVHSTAA       120
     LFEPGWAGTA TMELSNLGRM AVALYPGMRI CSFTFEQLSS PAMVPYRMKR GNKYAGQKDP       180
     KPSRLAEELS LEQLRGR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page