(data stored in ACNUC30630 zone)

EMBL: CP001275.GLPX

CP001275.GLPX        Location/Qualifiers
FT   CDS             340718..341725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="trd_0336"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF03320;
FT                   match to protein family HMM TIGR00330"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05080"
FT                   /db_xref="GOA:B9KXZ4"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ4"
FT                   /protein_id="ACM05080.1"
FT                   /translation="MDQLDRNLAMELVRTTEAAALAAAQWVGRGDKNAADAAAVQAMRR
FT                   MLSTVHMKGIVVIGEGEKDQAPMLYIGEEVGTGEPPESDLAVDPIDGTRLCANGMPGAV
FT                   SVVALAERGSMYYPPGIVYMNKIAVGPEAAHAIDIRLSPTENLHRIAEAKRMSVRLLTV
FT                   VVLDRPRHQALIEEIRRAGARIRLITDGDVAGAVMTAFPESGVDVLMGIGGSPEAVVAA
FT                   AALKCVGGAIQCTLYPRDEEERQRARELGLELEKVFTADDLVRSDNVFFAMTGITTGDL
FT                   VEGVRFTRHGAETHSIVMRSRTGTIRRIAAEHRLAKVQEYQTIAFDTDGRVMVE"
     MDQLDRNLAM ELVRTTEAAA LAAAQWVGRG DKNAADAAAV QAMRRMLSTV HMKGIVVIGE        60
     GEKDQAPMLY IGEEVGTGEP PESDLAVDPI DGTRLCANGM PGAVSVVALA ERGSMYYPPG       120
     IVYMNKIAVG PEAAHAIDIR LSPTENLHRI AEAKRMSVRL LTVVVLDRPR HQALIEEIRR       180
     AGARIRLITD GDVAGAVMTA FPESGVDVLM GIGGSPEAVV AAAALKCVGG AIQCTLYPRD       240
     EEERQRAREL GLELEKVFTA DDLVRSDNVF FAMTGITTGD LVEGVRFTRH GAETHSIVMR       300
     SRTGTIRRIA AEHRLAKVQE YQTIAFDTDG RVMVE                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page