(data stored in ACNUC30630 zone)

EMBL: CP001275.GPMI

CP001275.GPMI        Location/Qualifiers
FT   CDS             complement(634138..635712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="trd_0643"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06389"
FT                   /db_xref="GOA:B9KYT9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYT9"
FT                   /protein_id="ACM06389.1"
FT                   /translation="MDRPPMVCLVVLDGWAIGPDYPGNAIRAAHTPVMDRLQATYPMTT
FT                   LRCWGRDVGLPDDQMGNSEVGHLNLGAGRIVYQLITRIDLAIEDGSFFQNEAFQRALDR
FT                   ARQPGRTLHLMGLIGDGGVHSHQRHLLALLELAARAGISRVAVHAFTDGRDTAPTSGIE
FT                   HLRELLAALDRLRTGFVATVSGRYYAMDRDKRWERTKLAYDAIVCGLGQTARSPLEAIE
FT                   RSYAQGITDEFIVPTVIVDAEGKPLATINDGDAVIFFNFRADRARQLTQALTDAGGFTA
FT                   FPRCRWPRDLLMVTMAEYEPHFPVLVAFAPDIVRVPLARVLSDVGLRQFHTAETEKYAH
FT                   VTYFFNGGREEPFPGEDRLLVPSPKVPTYDLKPEMSAPEVTDAAVQAIVSQRYAFVLVN
FT                   YANPDMVGHTGVFAAAVAAVECVDRCLGRIEQAVRSVNGYLVVTADHGNADEMLVPGTN
FT                   EVWTAHTKNPVPFILVAPNHSPFRSVALRTGGRLADVAPTILEIMGLPQPEEMTGRSLI
FT                   VAPSVGR"
     MDRPPMVCLV VLDGWAIGPD YPGNAIRAAH TPVMDRLQAT YPMTTLRCWG RDVGLPDDQM        60
     GNSEVGHLNL GAGRIVYQLI TRIDLAIEDG SFFQNEAFQR ALDRARQPGR TLHLMGLIGD       120
     GGVHSHQRHL LALLELAARA GISRVAVHAF TDGRDTAPTS GIEHLRELLA ALDRLRTGFV       180
     ATVSGRYYAM DRDKRWERTK LAYDAIVCGL GQTARSPLEA IERSYAQGIT DEFIVPTVIV       240
     DAEGKPLATI NDGDAVIFFN FRADRARQLT QALTDAGGFT AFPRCRWPRD LLMVTMAEYE       300
     PHFPVLVAFA PDIVRVPLAR VLSDVGLRQF HTAETEKYAH VTYFFNGGRE EPFPGEDRLL       360
     VPSPKVPTYD LKPEMSAPEV TDAAVQAIVS QRYAFVLVNY ANPDMVGHTG VFAAAVAAVE       420
     CVDRCLGRIE QAVRSVNGYL VVTADHGNAD EMLVPGTNEV WTAHTKNPVP FILVAPNHSP       480
     FRSVALRTGG RLADVAPTIL EIMGLPQPEE MTGRSLIVAP SVGR                        524
//

If you have problems or comments...

PBIL Back to PBIL home page