(data stored in ACNUC30630 zone)

EMBL: CP001275.HISG

CP001275.HISG        Location/Qualifiers
FT   CDS             complement(626497..627516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="trd_0638"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="identified by match to protein family HMM PF01634;
FT                   match to protein family HMM TIGR00070; match to protein
FT                   family HMM TIGR03455"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05005"
FT                   /db_xref="GOA:B9KYT4"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT4"
FT                   /protein_id="ACM05005.1"
FT                   /translation="MAEPLRIAIASKGEYEQATLRFLESAGLSVWRPNPRQYVGRLAGF
FT                   EDVEILFQRTADIVQQVASGGADFGITGYDLVAELAGDDPDVLVVFDDLGFRRCQLVLA
FT                   VPESWLDVTTLADLADLAVEWKRRGRTMRIATKFPNLTREFLLRNGVNYFTLVEGHGAL
FT                   EIAPALGYADLIADLTETGVTLRENRLRVLEGGVILRAQACLIASRRALRAAPQKLQQA
FT                   RSIIELIEARLRSRRYRLITANIRGSSEDEVVRHVTAHAATTGERGPTVARVYPKLGED
FT                   GPGWYEVTIIVPQHLLLEAVDHLRLAGSSGITVTSPEYVFDSRSHAFARLCQALEEKA"
     MAEPLRIAIA SKGEYEQATL RFLESAGLSV WRPNPRQYVG RLAGFEDVEI LFQRTADIVQ        60
     QVASGGADFG ITGYDLVAEL AGDDPDVLVV FDDLGFRRCQ LVLAVPESWL DVTTLADLAD       120
     LAVEWKRRGR TMRIATKFPN LTREFLLRNG VNYFTLVEGH GALEIAPALG YADLIADLTE       180
     TGVTLRENRL RVLEGGVILR AQACLIASRR ALRAAPQKLQ QARSIIELIE ARLRSRRYRL       240
     ITANIRGSSE DEVVRHVTAH AATTGERGPT VARVYPKLGE DGPGWYEVTI IVPQHLLLEA       300
     VDHLRLAGSS GITVTSPEYV FDSRSHAFAR LCQALEEKA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page