(data stored in ACNUC30630 zone)

EMBL: CP001275.MGTE

CP001275.MGTE        Location/Qualifiers
FT   CDS             560974..562332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="trd_0564"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05121"
FT                   /db_xref="GOA:B9KYL8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL8"
FT                   /protein_id="ACM05121.1"
FT                   /translation="MATEMDIQMQLRSLLQRGERETVEDLLWELVEQRQLYAVLRELEP
FT                   FELARLAELLGDETFGEFLAELDPSDAADLLERLSSQEAADVLEAMAPDDAADVFARLD
FT                   PDEARQILVEMEPLEAQELQELLSYPPETAGGRMTPSYVALLPDVRVDQAIAALRKVAA
FT                   EVETIYYAYVVDEANHLLGVVSMRDLVLSPPYRTVGEIMTRDIVKVRATADQEEAARLL
FT                   VEEGLLAIPVVDDEDRLLGIITVDDVADILEREVTEDIERLGGSQPLEVPYTRATPFYL
FT                   WRRRIGWLLLLFVAEMYTGTVLRHFEQELEEAIALAFFVPLLIGTGGNAGSQVVTTLVR
FT                   AMAVEGIGIRDFFRIFPKEFIAGLLAGVVMGTAGFLRAEILGVDPAISLTVGVALFCIV
FT                   LWAVTVATLLPLLLRRLGIDPAVVSSPFIATLVDGTGLVIYFNVARIILHLHS"
     MATEMDIQMQ LRSLLQRGER ETVEDLLWEL VEQRQLYAVL RELEPFELAR LAELLGDETF        60
     GEFLAELDPS DAADLLERLS SQEAADVLEA MAPDDAADVF ARLDPDEARQ ILVEMEPLEA       120
     QELQELLSYP PETAGGRMTP SYVALLPDVR VDQAIAALRK VAAEVETIYY AYVVDEANHL       180
     LGVVSMRDLV LSPPYRTVGE IMTRDIVKVR ATADQEEAAR LLVEEGLLAI PVVDDEDRLL       240
     GIITVDDVAD ILEREVTEDI ERLGGSQPLE VPYTRATPFY LWRRRIGWLL LLFVAEMYTG       300
     TVLRHFEQEL EEAIALAFFV PLLIGTGGNA GSQVVTTLVR AMAVEGIGIR DFFRIFPKEF       360
     IAGLLAGVVM GTAGFLRAEI LGVDPAISLT VGVALFCIVL WAVTVATLLP LLLRRLGIDP       420
     AVVSSPFIAT LVDGTGLVIY FNVARIILHL HS                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page