(data stored in ACNUC30630 zone)

EMBL: CP001275.MRAW

CP001275.MRAW        Location/Qualifiers
FT   CDS             64032..65012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="trd_0056"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05553"
FT                   /db_xref="GOA:B9L274"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L274"
FT                   /protein_id="ACM05553.1"
FT                   /translation="MSERARLALEDPLSTTHEPVLLSAALTFLAPRDGGRYIDATFGGG
FT                   GHSRAILEASAPSGQVLAIDADPAAVARARALAERYPGRLLPCHGNFRDLARLAQSYGF
FT                   VPVDGILFDLGLSSDQLADPARGFSFQLAGPLDMRFDPTSGEPAAVIVNTWSAEELAEL
FT                   FWQYGEEPRAWAIAQTIVAERARQPIETTTQLAALVARVAGSRRERIHPATRVFQALRI
FT                   AVNQELEALAAGLAQAVELLRPGGRLVVIAFHSLEDRLVKQFFRREAAACLCPPGTPVC
FT                   ICGHRPRLRLLTPRPVRPSAEEITRNPRSRSARLRAAERIAHDGR"
     MSERARLALE DPLSTTHEPV LLSAALTFLA PRDGGRYIDA TFGGGGHSRA ILEASAPSGQ        60
     VLAIDADPAA VARARALAER YPGRLLPCHG NFRDLARLAQ SYGFVPVDGI LFDLGLSSDQ       120
     LADPARGFSF QLAGPLDMRF DPTSGEPAAV IVNTWSAEEL AELFWQYGEE PRAWAIAQTI       180
     VAERARQPIE TTTQLAALVA RVAGSRRERI HPATRVFQAL RIAVNQELEA LAAGLAQAVE       240
     LLRPGGRLVV IAFHSLEDRL VKQFFRREAA ACLCPPGTPV CICGHRPRLR LLTPRPVRPS       300
     AEEITRNPRS RSARLRAAER IAHDGR                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page