(data stored in ACNUC30630 zone)

EMBL: CP001275.MURB

CP001275.MURB        Location/Qualifiers
FT   CDS             73659..74618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="trd_0064"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873; match to protein
FT                   family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04484"
FT                   /db_xref="GOA:B9L282"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B9L282"
FT                   /protein_id="ACM04484.1"
FT                   /translation="MAMPTRAERSRVVTVDGRSLRVLVSEPLARYTTFRIGGPADFLVR
FT                   ASDRATLESALIWAEREGLPVTVIGGGSNLLVRDGGIRGLVIVFRAPGESVGELATAAQ
FT                   DDGSVLVTLPATAPLSWVGHWASEHGLAGMEWAAGLPGVVGGAVVNNAGAHGGEIGHVI
FT                   VDLELYDLPSRRLVRWTREQLAPRYRMTALKALSQPRSLVVLGARLRLLRDDPARLLAF
FT                   AEEHARWRRMHQPTGPCAGSVFTNPPGTYAGYLIEQAGLKGFRIGQMAVSERHANFFVN
FT                   LGGATAREALALIEAVQERVAERFGIVLQPEIEIIGES"
     MAMPTRAERS RVVTVDGRSL RVLVSEPLAR YTTFRIGGPA DFLVRASDRA TLESALIWAE        60
     REGLPVTVIG GGSNLLVRDG GIRGLVIVFR APGESVGELA TAAQDDGSVL VTLPATAPLS       120
     WVGHWASEHG LAGMEWAAGL PGVVGGAVVN NAGAHGGEIG HVIVDLELYD LPSRRLVRWT       180
     REQLAPRYRM TALKALSQPR SLVVLGARLR LLRDDPARLL AFAEEHARWR RMHQPTGPCA       240
     GSVFTNPPGT YAGYLIEQAG LKGFRIGQMA VSERHANFFV NLGGATAREA LALIEAVQER       300
     VAERFGIVLQ PEIEIIGES                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page