(data stored in ACNUC30630 zone)

EMBL: CP001275.MURC

CP001275.MURC        Location/Qualifiers
FT   CDS             72293..73681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="trd_0063"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04761"
FT                   /db_xref="GOA:B9L281"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9L281"
FT                   /protein_id="ACM04761.1"
FT                   /translation="MRWPAHLNHLQPGLPIHFLGIGGAGMSGLAELLADRGYRVTGCDV
FT                   AWSPVLDRLVARDIAVAVGHDERHAQDAHLLVVTSAVRAQHPEVAAFAAQRIPIVKRAA
FT                   LLGWLAASYRTIAVAGTHGKSTTCGMIALALDAAGLTPGFAIGAEVRDLGGTSARLPGG
FT                   NLFVVEADEYDYSFLFLEPDIAVVLNVDHDHPDLFPDRASVARAFRRFLARLRPVGTAV
FT                   VWADDPVACAVADELQSRGHRVVTFGETAEAAYRVLPDGALRDPSGAIWPLALAVPGRH
FT                   NRLNAAAAVAAVVQVGVPLVVAVRALEHFNGVGRRFEEVGIVNGVRVILDYAHHPREIA
FT                   ATIAAARERFPAARLWAVFQPHTYSRTARFLTEFAHALEQADLAVVAEIYAAREQPLAG
FT                   IDAAALASAIRRIPAIAVPDPMAAAETVGAAMRAGDVVLVLGAGDIWKAAVRLREGHGD
FT                   ADTG"
     MRWPAHLNHL QPGLPIHFLG IGGAGMSGLA ELLADRGYRV TGCDVAWSPV LDRLVARDIA        60
     VAVGHDERHA QDAHLLVVTS AVRAQHPEVA AFAAQRIPIV KRAALLGWLA ASYRTIAVAG       120
     THGKSTTCGM IALALDAAGL TPGFAIGAEV RDLGGTSARL PGGNLFVVEA DEYDYSFLFL       180
     EPDIAVVLNV DHDHPDLFPD RASVARAFRR FLARLRPVGT AVVWADDPVA CAVADELQSR       240
     GHRVVTFGET AEAAYRVLPD GALRDPSGAI WPLALAVPGR HNRLNAAAAV AAVVQVGVPL       300
     VVAVRALEHF NGVGRRFEEV GIVNGVRVIL DYAHHPREIA ATIAAARERF PAARLWAVFQ       360
     PHTYSRTARF LTEFAHALEQ ADLAVVAEIY AAREQPLAGI DAAALASAIR RIPAIAVPDP       420
     MAAAETVGAA MRAGDVVLVL GAGDIWKAAV RLREGHGDAD TG                          462
//

If you have problems or comments...

PBIL Back to PBIL home page