(data stored in ACNUC30630 zone)

EMBL: CP001275.PE1

CP001275.PE1         Location/Qualifiers
FT   CDS             102..1154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0002"
FT                   /product="DNA polymerase III tau and gamma subunits"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06107"
FT                   /db_xref="GOA:B9L1A1"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A1"
FT                   /protein_id="ACM06107.1"
FT                   /translation="MNATNDLSPSRATPGWPIIGHEGAVRTLARAIESGQVHHAYLLAG
FT                   PAGIGRTTLAFVFAQALLCEGAAEQRPCGTCRSCQRIARRVHPDVTRIGLDTGAEEAKQ
FT                   VSIDQVRELRASLSLRPLEGAWRVAIVDDAERLSREAADALLKTLEEPPPYAVLVLVAE
FT                   DAQALPETIRSRCQTIVLQPLPISVVARALEVRGAAPELANRLARETRGRIALAFRLVS
FT                   DEAARVQREKRVAEVIAAMTEPLAAIGFARRLAEQYRRGRRAEVLSSLQLALELWRDAL
FT                   WLAADPSAPIVHEDARTTLERFARRCGIAGACAGLSATLQALADLEANVQARLALDAAM
FT                   VTWAEVSRCA"
     MNATNDLSPS RATPGWPIIG HEGAVRTLAR AIESGQVHHA YLLAGPAGIG RTTLAFVFAQ        60
     ALLCEGAAEQ RPCGTCRSCQ RIARRVHPDV TRIGLDTGAE EAKQVSIDQV RELRASLSLR       120
     PLEGAWRVAI VDDAERLSRE AADALLKTLE EPPPYAVLVL VAEDAQALPE TIRSRCQTIV       180
     LQPLPISVVA RALEVRGAAP ELANRLARET RGRIALAFRL VSDEAARVQR EKRVAEVIAA       240
     MTEPLAAIGF ARRLAEQYRR GRRAEVLSSL QLALELWRDA LWLAADPSAP IVHEDARTTL       300
     ERFARRCGIA GACAGLSATL QALADLEANV QARLALDAAM VTWAEVSRCA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page