(data stored in ACNUC30630 zone)

EMBL: CP001275.PE114

CP001275.PE114       Location/Qualifiers
FT   CDS             complement(121514..122800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0116"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04879"
FT                   /db_xref="GOA:B9KXD0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD0"
FT                   /protein_id="ACM04879.1"
FT                   /translation="MMDGVRAEVLEFVEETKRYVYEELMPLEDEIERTDYLPPEVIADV
FT                   AKRGYFGMTIPKEYGGLGFNLLETCMVLEQIHKAPLAIGYVVDLNNGIGSLAILHGGSE
FT                   ELKREYLPRLARGEIIGVFAMSEPQVGSDGQGISTRAEWRDGYWVLNGVKYWITWAERG
FT                   DVFTVAAATDPGKGAHGGISVFLVPKGTPGMRVARRQKMMGNAGIDESVLVFEDCKVPA
FT                   ENLLGELGWGFRLLMRTLDEGRVKCCSLAIGYAERAWELAMAYVKRRQAFGQRLADFQG
FT                   IQWQLAEAATTIWLSRLAMYEAARKIDRGEFAAKEAAMAKLYSTEACQHVVDTAVQLFG
FT                   ARGYCRDYPLERIYRNYRSLRIVEGTSEIQRRIIWKQMSKLYDPERAPDERTREHAIRV
FT                   ERMLERALAVDRPYQDWGFRYLDEVAADD"
     MMDGVRAEVL EFVEETKRYV YEELMPLEDE IERTDYLPPE VIADVAKRGY FGMTIPKEYG        60
     GLGFNLLETC MVLEQIHKAP LAIGYVVDLN NGIGSLAILH GGSEELKREY LPRLARGEII       120
     GVFAMSEPQV GSDGQGISTR AEWRDGYWVL NGVKYWITWA ERGDVFTVAA ATDPGKGAHG       180
     GISVFLVPKG TPGMRVARRQ KMMGNAGIDE SVLVFEDCKV PAENLLGELG WGFRLLMRTL       240
     DEGRVKCCSL AIGYAERAWE LAMAYVKRRQ AFGQRLADFQ GIQWQLAEAA TTIWLSRLAM       300
     YEAARKIDRG EFAAKEAAMA KLYSTEACQH VVDTAVQLFG ARGYCRDYPL ERIYRNYRSL       360
     RIVEGTSEIQ RRIIWKQMSK LYDPERAPDE RTREHAIRVE RMLERALAVD RPYQDWGFRY       420
     LDEVAADD                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page