(data stored in ACNUC30630 zone)

EMBL: CP001275.PE117

CP001275.PE117       Location/Qualifiers
FT   CDS             complement(125806..126990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0119"
FT                   /product="putative transport system periplasmic protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05069"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD3"
FT                   /protein_id="ACM05069.1"
FT                   /translation="MADRIDALLQFLARQQRLRRRELLGGLLAAGTLAACRQAATPTPT
FT                   PAPAATPTPAAQAPAGEFAVPGYDDPNRWKGRSIVVTSWGGALQDALRKTIYQPFSRLT
FT                   GCQIVEDTTDEAKLRTMVESGTVEWDVVDVGTESVIPMGRLNLLEPLDYSKIDTTDIFP
FT                   ELVLEHGVGYFYYSTCLAYRKDKFPDKPPQSWADFWDVQGFPGPRAFQKYIQWGPLEAA
FT                   LLADGVPIDQLYPPDVDRAFRALDRLKPHVTVWWEAGAQPAQLLTDGEVYLTDAWIARI
FT                   QFLIEQGSTVLGYTWNQGRLSSDSLVIPRGSKNVDVAHDFINFALRPEVQRAFALAYPD
FT                   GPANKRAFEALPAERVAVLPSAPQNKALQVYPDYQWWADHLDEVVERFNSWIAR"
     MADRIDALLQ FLARQQRLRR RELLGGLLAA GTLAACRQAA TPTPTPAPAA TPTPAAQAPA        60
     GEFAVPGYDD PNRWKGRSIV VTSWGGALQD ALRKTIYQPF SRLTGCQIVE DTTDEAKLRT       120
     MVESGTVEWD VVDVGTESVI PMGRLNLLEP LDYSKIDTTD IFPELVLEHG VGYFYYSTCL       180
     AYRKDKFPDK PPQSWADFWD VQGFPGPRAF QKYIQWGPLE AALLADGVPI DQLYPPDVDR       240
     AFRALDRLKP HVTVWWEAGA QPAQLLTDGE VYLTDAWIAR IQFLIEQGST VLGYTWNQGR       300
     LSSDSLVIPR GSKNVDVAHD FINFALRPEV QRAFALAYPD GPANKRAFEA LPAERVAVLP       360
     SAPQNKALQV YPDYQWWADH LDEVVERFNS WIAR                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page