(data stored in ACNUC30630 zone)

EMBL: CP001275.PE121

CP001275.PE121       Location/Qualifiers
FT   CDS             complement(129807..130970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0123"
FT                   /product="putative oxidoreductase protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05323"
FT                   /db_xref="GOA:B9KXD7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD7"
FT                   /protein_id="ACM05323.1"
FT                   /translation="MSSDDVVIVGGGNLGLWTAYHLAQRGVRRILVCERYWAGYGATVR
FT                   SAGIMRQQGGSETAVKLGKWSRELYRKLGQELGLDSGFREVGYYVVASSPMEKAVFQRL
FT                   VELRTAHGVPNEWLDPEDLARRLPYVDWSRFAGATYTPNDGYVEPAIIVRNIVMAVRAA
FT                   GVELLEQCEVQGIEPLTSGYRVETSRGVFETERVIDAGGPRGARRIAEFVGIDVPVAAS
FT                   RHMVISFPERPPDMPANFPMMFVLAAGFYLRPDEQGVLLGFSNPLEQPDPSDRYLLEFD
FT                   WDYFEKLKPEWEATIPSLAGKAIGRAWTGSIDYTPDQLPIIDEPRFGFYVLAAGGHGIM
FT                   WGPALGMKMAELVTEERLSDLDPEEVRLRRFTEGRMATDAIHLPFPH"
     MSSDDVVIVG GGNLGLWTAY HLAQRGVRRI LVCERYWAGY GATVRSAGIM RQQGGSETAV        60
     KLGKWSRELY RKLGQELGLD SGFREVGYYV VASSPMEKAV FQRLVELRTA HGVPNEWLDP       120
     EDLARRLPYV DWSRFAGATY TPNDGYVEPA IIVRNIVMAV RAAGVELLEQ CEVQGIEPLT       180
     SGYRVETSRG VFETERVIDA GGPRGARRIA EFVGIDVPVA ASRHMVISFP ERPPDMPANF       240
     PMMFVLAAGF YLRPDEQGVL LGFSNPLEQP DPSDRYLLEF DWDYFEKLKP EWEATIPSLA       300
     GKAIGRAWTG SIDYTPDQLP IIDEPRFGFY VLAAGGHGIM WGPALGMKMA ELVTEERLSD       360
     LDPEEVRLRR FTEGRMATDA IHLPFPH                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page