(data stored in ACNUC30630 zone)

EMBL: CP001275.PE126

CP001275.PE126       Location/Qualifiers
FT   CDS             complement(135215..135898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0129"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04471"
FT                   /db_xref="GOA:B9KXE2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE2"
FT                   /protein_id="ACM04471.1"
FT                   /translation="MPAGLGNSRGHRQLLHQQAYEVIRNAIVQSDLPPGSVVSERTLSE
FT                   QFGFGRAPIRAAIQRLAAEGFLLIVPQQGIIVASPSLEEVRDLFELRVALESYVVRRLA
FT                   LEPQEVDFVHLELLLEKQEKAAQEQNVRLYRQLDVDFHLFLAHSLGNSELYSSMERLSD
FT                   RLHRIIASVISRRPARMLDSTIEHRAIVQAIATGDPDAAEMAMITHLDWAWNFLTGGHL
FT                   PRHGR"
     MPAGLGNSRG HRQLLHQQAY EVIRNAIVQS DLPPGSVVSE RTLSEQFGFG RAPIRAAIQR        60
     LAAEGFLLIV PQQGIIVASP SLEEVRDLFE LRVALESYVV RRLALEPQEV DFVHLELLLE       120
     KQEKAAQEQN VRLYRQLDVD FHLFLAHSLG NSELYSSMER LSDRLHRIIA SVISRRPARM       180
     LDSTIEHRAI VQAIATGDPD AAEMAMITHL DWAWNFLTGG HLPRHGR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page