(data stored in ACNUC30630 zone)

EMBL: CP001275.PE134

CP001275.PE134       Location/Qualifiers
FT   CDS             complement(144776..145684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0137"
FT                   /product="sugar abc transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04696"
FT                   /db_xref="GOA:B9KXF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF0"
FT                   /protein_id="ACM04696.1"
FT                   /translation="MRTSEATTGPYPIVPAEVARPIRSTGRRLRHRLIWATMIIFALFC
FT                   IVPIYWILITALRPRGEIFESPALLYPQHITLDNLRYVWLGSQTNDPVLPFVFTSFLVA
FT                   TASACLTLFLSLPAAYALSRWRVGGNHLAMWILSQRFIPPIAVIVPLYLLYRRIGWLDT
FT                   YHGLILLYTVINIPITVWILRNYIDALPRDIEEAALVDGATPVQILRHIVLPLSWPSLG
FT                   AAAILAFLAIWNEYVFAYQLAGRNVAMVTVYFPRLRSAIGELYGEVAAAGLLALLPALL
FT                   VTGFLRRYIVRGLTLGGGREL"
     MRTSEATTGP YPIVPAEVAR PIRSTGRRLR HRLIWATMII FALFCIVPIY WILITALRPR        60
     GEIFESPALL YPQHITLDNL RYVWLGSQTN DPVLPFVFTS FLVATASACL TLFLSLPAAY       120
     ALSRWRVGGN HLAMWILSQR FIPPIAVIVP LYLLYRRIGW LDTYHGLILL YTVINIPITV       180
     WILRNYIDAL PRDIEEAALV DGATPVQILR HIVLPLSWPS LGAAAILAFL AIWNEYVFAY       240
     QLAGRNVAMV TVYFPRLRSA IGELYGEVAA AGLLALLPAL LVTGFLRRYI VRGLTLGGGR       300
     EL                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page