(data stored in ACNUC30630 zone)

EMBL: CP001275.PE136

CP001275.PE136       Location/Qualifiers
FT   CDS             complement(146698..146988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05486"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF2"
FT                   /protein_id="ACM05486.1"
FT                   /translation="MYATYVVREMDAATRAMTLERAANEFWPQLRAAAGFRHYYLIQQS
FT                   DSQTLGIILWDTAEQAAAFAAVTDGWQSTMDNLGHRRIVSGGGDVLEIAEG"
     MYATYVVREM DAATRAMTLE RAANEFWPQL RAAAGFRHYY LIQQSDSQTL GIILWDTAEQ        60
     AAAFAAVTDG WQSTMDNLGH RRIVSGGGDV LEIAEG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page