(data stored in ACNUC30630 zone)

EMBL: CP001275.PE143

CP001275.PE143       Location/Qualifiers
FT   CDS             complement(155440..155913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05249"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF9"
FT                   /protein_id="ACM05249.1"
FT                   /translation="MSAGCPDQLASAFAQRFRVLARALDRLDRLEGERAFVGWLDQLTE
FT                   QPHVLQDASEALVLQALRAASDPMNLALLRHLSVEEATGLAELAAELPLERIALHVRLG
FT                   ELAQAGLVALELEREAARLTALGNALRDWLDTLIRCTLDQVGAWLELVRSTQS"
     MSAGCPDQLA SAFAQRFRVL ARALDRLDRL EGERAFVGWL DQLTEQPHVL QDASEALVLQ        60
     ALRAASDPMN LALLRHLSVE EATGLAELAA ELPLERIALH VRLGELAQAG LVALELEREA       120
     ARLTALGNAL RDWLDTLIRC TLDQVGAWLE LVRSTQS                                157
//

If you have problems or comments...

PBIL Back to PBIL home page