(data stored in ACNUC30630 zone)

EMBL: CP001275.PE172

CP001275.PE172       Location/Qualifiers
FT   CDS             182192..182920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0175"
FT                   /product="putative glycoprotease family"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06082"
FT                   /db_xref="GOA:B9KXI8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI8"
FT                   /protein_id="ACM06082.1"
FT                   /translation="MERSDQLLLALDSGGEQVAIALYDGRVVGELLYDAGREHTATVLP
FT                   RIRQLLAENRRTIRDVAAVAVTTGPGSFNGLRVGMSIAKALCYALDVPLIGVLTLDALA
FT                   YPHTALPYPIRAFVAAGRGRVVYADYRRQGEIWVRDSSLRSVRLHEVTDGLLGRTVLTG
FT                   HLAPEEEALVRSHPLVILPAPALRQLRPAWVAELAFRRWQAGESDPVAALEPIYVHGGG
FT                   AEAIPSVQLPMSYDVRPARE"
     MERSDQLLLA LDSGGEQVAI ALYDGRVVGE LLYDAGREHT ATVLPRIRQL LAENRRTIRD        60
     VAAVAVTTGP GSFNGLRVGM SIAKALCYAL DVPLIGVLTL DALAYPHTAL PYPIRAFVAA       120
     GRGRVVYADY RRQGEIWVRD SSLRSVRLHE VTDGLLGRTV LTGHLAPEEE ALVRSHPLVI       180
     LPAPALRQLR PAWVAELAFR RWQAGESDPV AALEPIYVHG GGAEAIPSVQ LPMSYDVRPA       240
     RE                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page