(data stored in ACNUC30630 zone)

EMBL: CP001275.PE187

CP001275.PE187       Location/Qualifiers
FT   CDS             complement(194995..196659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0190"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06388"
FT                   /db_xref="GOA:B9KXK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK3"
FT                   /protein_id="ACM06388.1"
FT                   /translation="MIEVEALRYRYPTSRYPALVAPHWAVEAGEFVLLAGETGSGKTTL
FT                   LRSLVSLVPHFYGGWFGGRVLVGGRDTRHHRPADLAGLVGYVGQEPETQTLLDRVWDEI
FT                   AFALENLGFPPRVVAARVEEALDLLGLAHLRNRPIETLSGGERQRLTLASVLALRPQLL
FT                   LLDEPTSQLDPWSAETVLEVLRRLVDELGITLVIAEHRLDRLLGSCTRLTLLEDGKIVA
FT                   DGSPQHVAERLPDPPILVQVSRLLGWSPPALSVAEGKRRLRGCQLLSPVQRPAPSPGPT
FT                   PLALERIACRRGERLVLEDVTLEVARGLVTGIVGRNGSGKTTLLRAALGLEGIVRGRVW
FT                   LGGRPVHETLRAGESGSIAYVPQYPGALLVGSRLRDDLELVARVRQVSTTAVDEIVDLF
FT                   ELHPLLDTHPADLSSGERQRAALAVALTGHPALIVLDEPTRGLGLRLKQRLASELRRRA
FT                   AAGAAVLLTTHDVDFAAMVADRIVLLSEGRIVNEGPPHLVLGESFSYAPIVSRLFGPSF
FT                   VTVSDVEQALRENPAPAKHARIGYTEGDYGEFDRERA"
     MIEVEALRYR YPTSRYPALV APHWAVEAGE FVLLAGETGS GKTTLLRSLV SLVPHFYGGW        60
     FGGRVLVGGR DTRHHRPADL AGLVGYVGQE PETQTLLDRV WDEIAFALEN LGFPPRVVAA       120
     RVEEALDLLG LAHLRNRPIE TLSGGERQRL TLASVLALRP QLLLLDEPTS QLDPWSAETV       180
     LEVLRRLVDE LGITLVIAEH RLDRLLGSCT RLTLLEDGKI VADGSPQHVA ERLPDPPILV       240
     QVSRLLGWSP PALSVAEGKR RLRGCQLLSP VQRPAPSPGP TPLALERIAC RRGERLVLED       300
     VTLEVARGLV TGIVGRNGSG KTTLLRAALG LEGIVRGRVW LGGRPVHETL RAGESGSIAY       360
     VPQYPGALLV GSRLRDDLEL VARVRQVSTT AVDEIVDLFE LHPLLDTHPA DLSSGERQRA       420
     ALAVALTGHP ALIVLDEPTR GLGLRLKQRL ASELRRRAAA GAAVLLTTHD VDFAAMVADR       480
     IVLLSEGRIV NEGPPHLVLG ESFSYAPIVS RLFGPSFVTV SDVEQALREN PAPAKHARIG       540
     YTEGDYGEFD RERA                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page