(data stored in ACNUC30630 zone)

EMBL: CP001275.PE191

CP001275.PE191       Location/Qualifiers
FT   CDS             complement(200776..202062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0194"
FT                   /product="1,3-propanediol dehydrogenase"
FT                   /EC_number="1.1.1.202"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05889"
FT                   /db_xref="GOA:B9KXK7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK7"
FT                   /protein_id="ACM05889.1"
FT                   /translation="MSANLTQTVIAMDLVPFRFGPGATADVTVELERLGARRVLLVTDR
FT                   HLRQHGLVEPVEAAILRAGAEVVVFDQVHIEPTDRSLRDAIAFAQRVQPDAYVSLGGGS
FT                   TIDTAKAMNLFTSYPADLFDYINKPVGRGNPVPGPLKPHLALPTTAGTGSETTAVIALE
FT                   LTDRRLKTGISHRFIRPTMAIVDPLNTVTCPPMVTAFAGLDVLCHAIESYTAKPYHVRP
FT                   RPDSPTERPAYIGSNPVADLWSAQAIRWGARYLRRAVYNPLDLEARTFMALASLTAGIG
FT                   FGNAGVHIPHAMSYPIAGLVRDFFPPNYEVDEPLIPHGLAVVVGAPAGLRFTAPAWPER
FT                   HAEVAEMLGIDTRGLPVRAAAEAVADALIQLMRDLGLPSGLAELGFTESDIPALVEGTL
FT                   AQQRILVNSPRPVDERALRAIYREAMRYW"
     MSANLTQTVI AMDLVPFRFG PGATADVTVE LERLGARRVL LVTDRHLRQH GLVEPVEAAI        60
     LRAGAEVVVF DQVHIEPTDR SLRDAIAFAQ RVQPDAYVSL GGGSTIDTAK AMNLFTSYPA       120
     DLFDYINKPV GRGNPVPGPL KPHLALPTTA GTGSETTAVI ALELTDRRLK TGISHRFIRP       180
     TMAIVDPLNT VTCPPMVTAF AGLDVLCHAI ESYTAKPYHV RPRPDSPTER PAYIGSNPVA       240
     DLWSAQAIRW GARYLRRAVY NPLDLEARTF MALASLTAGI GFGNAGVHIP HAMSYPIAGL       300
     VRDFFPPNYE VDEPLIPHGL AVVVGAPAGL RFTAPAWPER HAEVAEMLGI DTRGLPVRAA       360
     AEAVADALIQ LMRDLGLPSG LAELGFTESD IPALVEGTLA QQRILVNSPR PVDERALRAI       420
     YREAMRYW                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page