(data stored in ACNUC30630 zone)

EMBL: CP001275.PE211

CP001275.PE211       Location/Qualifiers
FT   CDS             complement(223814..225205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0214"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06077"
FT                   /db_xref="GOA:B9KXM7"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM7"
FT                   /protein_id="ACM06077.1"
FT                   /translation="MLRGGRLVDPSQGIDGEADLLVADGQVRAVGGRVPEPSGATVIDA
FT                   AGLVVAPGFVDVHAHLRDPGFPEKETLETGSVAAAAGGFTTICCMPNTMPPLDTPERIR
FT                   ELVERARSLPVRIFPIGTISRGRRGEELADLVGMAEAGAIGFSDDGDSTRSARVMRQAL
FT                   QLSRLLGRPIMVHCEDPTLSAGGVMHEGGVSQQLGLPGIPAAAEEIVLARDLELARLTG
FT                   GWLHVLHLTTARGLMLVRRAKREGNRVTVEVTPHHLLMTDEWVAGIRRFAGEMKPFPAG
FT                   PCPDPNAKVNPPLRPEADALALRAGLRDGTIDLIATDHAPHHEQDKPPVLERAAFGMIG
FT                   LELALPLLLRLVRTGALTVSELVEFLSCRPATLFGLPGGTLRPGSPADVVVFDPEEPWQ
FT                   VTRATLRSRSANTPLLGLTLRGRVRLTIVGGKVAYVDTAFADRCTRSGRRADLSGYSLR
FT                   STPPG"
     MLRGGRLVDP SQGIDGEADL LVADGQVRAV GGRVPEPSGA TVIDAAGLVV APGFVDVHAH        60
     LRDPGFPEKE TLETGSVAAA AGGFTTICCM PNTMPPLDTP ERIRELVERA RSLPVRIFPI       120
     GTISRGRRGE ELADLVGMAE AGAIGFSDDG DSTRSARVMR QALQLSRLLG RPIMVHCEDP       180
     TLSAGGVMHE GGVSQQLGLP GIPAAAEEIV LARDLELARL TGGWLHVLHL TTARGLMLVR       240
     RAKREGNRVT VEVTPHHLLM TDEWVAGIRR FAGEMKPFPA GPCPDPNAKV NPPLRPEADA       300
     LALRAGLRDG TIDLIATDHA PHHEQDKPPV LERAAFGMIG LELALPLLLR LVRTGALTVS       360
     ELVEFLSCRP ATLFGLPGGT LRPGSPADVV VFDPEEPWQV TRATLRSRSA NTPLLGLTLR       420
     GRVRLTIVGG KVAYVDTAFA DRCTRSGRRA DLSGYSLRST PPG                         463
//

If you have problems or comments...

PBIL Back to PBIL home page