(data stored in ACNUC30630 zone)

EMBL: CP001275.PE214

CP001275.PE214       Location/Qualifiers
FT   CDS             227907..228257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0217"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by match to protein family HMM PF02675"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05212"
FT                   /db_xref="GOA:B9KXN0"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXN0"
FT                   /protein_id="ACM05212.1"
FT                   /translation="MKSLGRHVIVELWGCQNIDSLQAVEEAIRDAVAATNATLRDLQVF
FT                   PWEPYNGVSGIAILSESHLSIHTWPELGYAAVDVFTCGEHTNPEAAIPVLRERFRPQRM
FT                   EVMQVSRGMIVD"
     MKSLGRHVIV ELWGCQNIDS LQAVEEAIRD AVAATNATLR DLQVFPWEPY NGVSGIAILS        60
     ESHLSIHTWP ELGYAAVDVF TCGEHTNPEA AIPVLRERFR PQRMEVMQVS RGMIVD           116
//

If you have problems or comments...

PBIL Back to PBIL home page