(data stored in ACNUC30630 zone)

EMBL: CP001275.PE216

CP001275.PE216       Location/Qualifiers
FT   CDS             complement(229339..230604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05453"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN2"
FT                   /protein_id="ACM05453.1"
FT                   /translation="MAIQIETSSLPVLAQPTSLEEAGLDLQLVLELALKFLYAHGTQTA
FT                   RELVEALCLPFAGLLERALSQAKREELVEITGSNGIGELGYRYALTSKGHQRAQEFLAR
FT                   NGYIGPAPVPIEQYRQIVAAQSLRHLSVTPRMIKEALGPLVFTESVLDQIGQALNSGQA
FT                   IFLFGKPGNGKTALAQRVVAMYGGAVFIPHAILVDTQIIRVFDRHHHHPLPEQPTSDRR
FT                   WMLCARPLIQVGGELTLEQLDLIYDERNRLYEAPLQLRANNGVLLIDDFGRQRVPPRAL
FT                   LNRWIVPLEQRIDILTLHTGKQVEVPFEGLVIFSTNLQPTDLVDEAFLRRIPNKIHLAN
FT                   PTVQQFAEIFRRQCAELGVPFDQRGLAYLLRTYYVGKRELRACHPRDLLRALIGAARYL
FT                   GQEPRLTPDLIDRACRSYFIDP"
     MAIQIETSSL PVLAQPTSLE EAGLDLQLVL ELALKFLYAH GTQTARELVE ALCLPFAGLL        60
     ERALSQAKRE ELVEITGSNG IGELGYRYAL TSKGHQRAQE FLARNGYIGP APVPIEQYRQ       120
     IVAAQSLRHL SVTPRMIKEA LGPLVFTESV LDQIGQALNS GQAIFLFGKP GNGKTALAQR       180
     VVAMYGGAVF IPHAILVDTQ IIRVFDRHHH HPLPEQPTSD RRWMLCARPL IQVGGELTLE       240
     QLDLIYDERN RLYEAPLQLR ANNGVLLIDD FGRQRVPPRA LLNRWIVPLE QRIDILTLHT       300
     GKQVEVPFEG LVIFSTNLQP TDLVDEAFLR RIPNKIHLAN PTVQQFAEIF RRQCAELGVP       360
     FDQRGLAYLL RTYYVGKREL RACHPRDLLR ALIGAARYLG QEPRLTPDLI DRACRSYFID       420
     P                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page