(data stored in ACNUC30630 zone)

EMBL: CP001275.PE217

CP001275.PE217       Location/Qualifiers
FT   CDS             complement(230715..231695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0220"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04601"
FT                   /db_xref="GOA:B9KXN3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN3"
FT                   /protein_id="ACM04601.1"
FT                   /translation="MSERRRRSIPIILALVTVAVVAGLWLWLRRPSETVWVTQRADLTA
FT                   SVEVPGRLVSLRTLPLRASYETRVRLLAVAPGDRVRAGDIVAVLDDTPLLTRRAQAEQQ
FT                   LLQAEATLSQAEATDAPLEVRLRAEQQRREAARAFDEVTRRLADKYVLAPSDGIVTELL
FT                   VSEGAPVTTGSILARLADTSVLGVSATIDEVDARFFAEATTVRVTVDALPGWQGRGEVV
FT                   GRGESATQQAGIVGFPLLIRLAETASDLRPGMTATIHLDTIVRHDVLVVPERAIRTVGE
FT                   RAFVTVVTNGRREEREVTLGLRSSGLVEIAAGLAEGEQVLLPAGN"
     MSERRRRSIP IILALVTVAV VAGLWLWLRR PSETVWVTQR ADLTASVEVP GRLVSLRTLP        60
     LRASYETRVR LLAVAPGDRV RAGDIVAVLD DTPLLTRRAQ AEQQLLQAEA TLSQAEATDA       120
     PLEVRLRAEQ QRREAARAFD EVTRRLADKY VLAPSDGIVT ELLVSEGAPV TTGSILARLA       180
     DTSVLGVSAT IDEVDARFFA EATTVRVTVD ALPGWQGRGE VVGRGESATQ QAGIVGFPLL       240
     IRLAETASDL RPGMTATIHL DTIVRHDVLV VPERAIRTVG ERAFVTVVTN GRREEREVTL       300
     GLRSSGLVEI AAGLAEGEQV LLPAGN                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page