(data stored in ACNUC30630 zone)

EMBL: CP001275.PE218

CP001275.PE218       Location/Qualifiers
FT   CDS             complement(231688..234039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0221"
FT                   /product="putative permease domain protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05808"
FT                   /db_xref="GOA:B9KXN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN4"
FT                   /protein_id="ACM05808.1"
FT                   /translation="MPIALLAAFAMRSLRLRRIRATLAGASIALAVFAVVAIRSAGLAL
FT                   IEAQQRTYAATGQPDIVASVHGLTPGLVAALARRDGVLEAESRLIQSSRLTVDGRWRAV
FT                   RLVGIERFDQLALDRPELVAGRWPERGEVVLDVTARHLLGIEIGTLVAFQANPGDPIHY
FT                   ARVSGFAWVPARPSATLLDQFTAYVPLRTLRQWTGSEAANTLLVRVDNPALAGRVASEL
FT                   QRFLAARQIPSSGWTVRDPDSFLGARELATLLLLLRAFAILGTLTALFIVANTTIGLVT
FT                   EERPQLGTLRALGTTRSQLVSAYLAPHIVIGTAGSVVGLLAGTAGGYVLTAYLAGLAGL
FT                   VLPPLRVAPSSVLLALGCGLGIAVAGALGPILHATRTPAAQLLRGDTRAPGDPPRWLTR
FT                   STGWLAQRSPILGMSTRDPFRRPLRAALTVLVTAVALAALLASQIVDHSLRAGIAALYD
FT                   RYRADAWLLTNPPVPPTYAHRLANSPPVRAAEPWVLTSGAIGSVRTDVWGLPAKTSVYQ
FT                   PVMLAGQWLDDAPAAYPPRAVITGNLARRLDAQVGDVLPLDLGRQRLPIQVSGIVDDES
FT                   TYLGATAIGKVFLDHQILTRLLGRDDRAALYALRFWDTVRPSDSLTTVEQYARTLRPLT
FT                   LLMAEDRAATERVLAVLTILARIVVLVITIATVFGITNALLLDLTERRREFGILRTLGT
FT                   ERATLVLLLAGQTLVIVVFGALLAVPVGFLLAVNILALVSRQLFAIPLALPSTVVLVLI
FT                   AAVALTTALAVLIPALLAVRLRPVEVLRYE"
     MPIALLAAFA MRSLRLRRIR ATLAGASIAL AVFAVVAIRS AGLALIEAQQ RTYAATGQPD        60
     IVASVHGLTP GLVAALARRD GVLEAESRLI QSSRLTVDGR WRAVRLVGIE RFDQLALDRP       120
     ELVAGRWPER GEVVLDVTAR HLLGIEIGTL VAFQANPGDP IHYARVSGFA WVPARPSATL       180
     LDQFTAYVPL RTLRQWTGSE AANTLLVRVD NPALAGRVAS ELQRFLAARQ IPSSGWTVRD       240
     PDSFLGAREL ATLLLLLRAF AILGTLTALF IVANTTIGLV TEERPQLGTL RALGTTRSQL       300
     VSAYLAPHIV IGTAGSVVGL LAGTAGGYVL TAYLAGLAGL VLPPLRVAPS SVLLALGCGL       360
     GIAVAGALGP ILHATRTPAA QLLRGDTRAP GDPPRWLTRS TGWLAQRSPI LGMSTRDPFR       420
     RPLRAALTVL VTAVALAALL ASQIVDHSLR AGIAALYDRY RADAWLLTNP PVPPTYAHRL       480
     ANSPPVRAAE PWVLTSGAIG SVRTDVWGLP AKTSVYQPVM LAGQWLDDAP AAYPPRAVIT       540
     GNLARRLDAQ VGDVLPLDLG RQRLPIQVSG IVDDESTYLG ATAIGKVFLD HQILTRLLGR       600
     DDRAALYALR FWDTVRPSDS LTTVEQYART LRPLTLLMAE DRAATERVLA VLTILARIVV       660
     LVITIATVFG ITNALLLDLT ERRREFGILR TLGTERATLV LLLAGQTLVI VVFGALLAVP       720
     VGFLLAVNIL ALVSRQLFAI PLALPSTVVL VLIAAVALTT ALAVLIPALL AVRLRPVEVL       780
     RYE                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page