(data stored in ACNUC30630 zone)

EMBL: CP001275.PE222

CP001275.PE222       Location/Qualifiers
FT   CDS             complement(236968..237228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0225"
FT                   /product="Transglycosylase associated protein"
FT                   /note="identified by match to protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04783"
FT                   /db_xref="GOA:B9KXN8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN8"
FT                   /protein_id="ACM04783.1"
FT                   /translation="MLPAEPRSLLGWLVIGFLAGWLAGLLTRGRGFGCLGNIAIGLLGA
FT                   VVGGYLFQLLGVRGPAGFLGSLLVALVGAGVLLLVVNLMRR"
     MLPAEPRSLL GWLVIGFLAG WLAGLLTRGR GFGCLGNIAI GLLGAVVGGY LFQLLGVRGP        60
     AGFLGSLLVA LVGAGVLLLV VNLMRR                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page