(data stored in ACNUC30630 zone)

EMBL: CP001275.PE227

CP001275.PE227       Location/Qualifiers
FT   CDS             241090..241803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0230"
FT                   /product="putative Stage II sporulation protein E (SpoIIE)"
FT                   /note="identified by match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05304"
FT                   /db_xref="GOA:B9KXP3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP3"
FT                   /protein_id="ACM05304.1"
FT                   /translation="MTLTIELAVAKTHRAGNRESGDTVELIERPGGGLSVVLVDAQGSG
FT                   MAAKLLSLQVAGRVLTLLNEGVRDGAAARAAHDFLFTLRGGRVSAELDIVSVDLASRTL
FT                   VVTRNSEAPLVLIRDSDVEIVASTGGRIGLYRHTRPSVTEWTLEPGLTVIVVSDGVAHA
FT                   GAHAGKTIDLATLARQESVACETAQQLADRVLSAALAADRGHPRDDMTVVVLRLQAGGV
FT                   RQPVRRLSLTFPLTE"
     MTLTIELAVA KTHRAGNRES GDTVELIERP GGGLSVVLVD AQGSGMAAKL LSLQVAGRVL        60
     TLLNEGVRDG AAARAAHDFL FTLRGGRVSA ELDIVSVDLA SRTLVVTRNS EAPLVLIRDS       120
     DVEIVASTGG RIGLYRHTRP SVTEWTLEPG LTVIVVSDGV AHAGAHAGKT IDLATLARQE       180
     SVACETAQQL ADRVLSAALA ADRGHPRDDM TVVVLRLQAG GVRQPVRRLS LTFPLTE          237
//

If you have problems or comments...

PBIL Back to PBIL home page