(data stored in ACNUC30630 zone)

EMBL: CP001275.PE238

CP001275.PE238       Location/Qualifiers
FT   CDS             complement(250690..251166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01878"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05059"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ4"
FT                   /protein_id="ACM05059.1"
FT                   /translation="MAEPQYWILVGSAENLEATQAHGFTVQGFKSRHRKKAEAMRPGDR
FT                   LVYYVTGIQGFAAIARVTSDAFEDHTPIWKSKDPKKAAEDYPWRVQIEPEIALPPGVYL
FT                   PAEDIALQLHHVQKWPKDHWRLAFQGQLHRIDEHDYELIRTALVQAANRQSVAP"
     MAEPQYWILV GSAENLEATQ AHGFTVQGFK SRHRKKAEAM RPGDRLVYYV TGIQGFAAIA        60
     RVTSDAFEDH TPIWKSKDPK KAAEDYPWRV QIEPEIALPP GVYLPAEDIA LQLHHVQKWP       120
     KDHWRLAFQG QLHRIDEHDY ELIRTALVQA ANRQSVAP                               158
//

If you have problems or comments...

PBIL Back to PBIL home page