(data stored in ACNUC30630 zone)

EMBL: CP001275.PE244

CP001275.PE244       Location/Qualifiers
FT   CDS             complement(254409..255161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0248"
FT                   /product="putative dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04859"
FT                   /db_xref="GOA:B9KXR0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR0"
FT                   /protein_id="ACM04859.1"
FT                   /translation="MQLHDRIALVTGAGSGIGRAIAERFASAGALVIAADLDATAAEET
FT                   ARRAPERIVPDHVDVRDEASVRTLMERTLDRFGRLDILVNNAGIGTTKDLVETDLAEWE
FT                   NVFAVNVRGVFLCCKYALPSMLARRSGVIINIGSVAGLIGIPKRAAYCASKGAVVTLTK
FT                   QIAIAYVREGIRCNCICPGTVDSPWVERLVAREPDPVAARRALEARQPMGRLVQPEEVA
FT                   AAALYLASDEAAAVTGSILVIDGGWLAQ"
     MQLHDRIALV TGAGSGIGRA IAERFASAGA LVIAADLDAT AAEETARRAP ERIVPDHVDV        60
     RDEASVRTLM ERTLDRFGRL DILVNNAGIG TTKDLVETDL AEWENVFAVN VRGVFLCCKY       120
     ALPSMLARRS GVIINIGSVA GLIGIPKRAA YCASKGAVVT LTKQIAIAYV REGIRCNCIC       180
     PGTVDSPWVE RLVAREPDPV AARRALEARQ PMGRLVQPEE VAAAALYLAS DEAAAVTGSI       240
     LVIDGGWLAQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page