(data stored in ACNUC30630 zone)

EMBL: CP001275.PE255

CP001275.PE255       Location/Qualifiers
FT   CDS             263731..263964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0259"
FT                   /product="putative ABC transport system, substrate-binding
FT                   protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05275"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS1"
FT                   /protein_id="ACM05275.1"
FT                   /translation="MMTEALRAVDGAVEERGRFLAALRAVEFTGPTGRFRFYPESQGAV
FT                   ITVFVRRVERLPNGELGNVMLDRVRDVDDVSF"
     MMTEALRAVD GAVEERGRFL AALRAVEFTG PTGRFRFYPE SQGAVITVFV RRVERLPNGE        60
     LGNVMLDRVR DVDDVSF                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page