(data stored in ACNUC30630 zone)

EMBL: CP001275.PE258

CP001275.PE258       Location/Qualifiers
FT   CDS             267107..268456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0262"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding:Protein of
FT                   unknown function, cysteine-rich region"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05509"
FT                   /db_xref="GOA:B9KXS4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS4"
FT                   /protein_id="ACM05509.1"
FT                   /translation="MTTASAPARLRGFSGRDAPSYDAIRKCVHCGFCLPSCPTYRVTWR
FT                   ERSSPRGRIWLMKSVAEGRLDLLDPVFAEEMQLCLNCRACEAVCPSGVHYGEILEASRA
FT                   QLVQHREQSWRERLFRLAGFRILLGDMRRFRAANALLRWYQRSPLRPLVRRSGVLRLLG
FT                   LEQAEALLPAIADRFVVADGRFVPAQGERRGRVALFTGCVMSTAYAHVHEATIRVLTRN
FT                   GFDVVLVSGQQCCGALHVHSGEPELGRRLARQNIEALESPYLDAIIVNAAGCGAMLKEY
FT                   PALLRQDHDYAERARQLAGKVRDVLEFLVERGLTAQPGPLPWTVTYQEPCHLAHAQRIT
FT                   QQPRVLLRTIPQLRLVEMAESALCCGSAGIYNLLQPDMASTLLARKLDNALATGADVIV
FT                   SANPGCMLQLEAGLRARGVRLPVLHLVEVLDRAYAAAEGRPADILAAVAD"
     MTTASAPARL RGFSGRDAPS YDAIRKCVHC GFCLPSCPTY RVTWRERSSP RGRIWLMKSV        60
     AEGRLDLLDP VFAEEMQLCL NCRACEAVCP SGVHYGEILE ASRAQLVQHR EQSWRERLFR       120
     LAGFRILLGD MRRFRAANAL LRWYQRSPLR PLVRRSGVLR LLGLEQAEAL LPAIADRFVV       180
     ADGRFVPAQG ERRGRVALFT GCVMSTAYAH VHEATIRVLT RNGFDVVLVS GQQCCGALHV       240
     HSGEPELGRR LARQNIEALE SPYLDAIIVN AAGCGAMLKE YPALLRQDHD YAERARQLAG       300
     KVRDVLEFLV ERGLTAQPGP LPWTVTYQEP CHLAHAQRIT QQPRVLLRTI PQLRLVEMAE       360
     SALCCGSAGI YNLLQPDMAS TLLARKLDNA LATGADVIVS ANPGCMLQLE AGLRARGVRL       420
     PVLHLVEVLD RAYAAAEGRP ADILAAVAD                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page