(data stored in ACNUC30630 zone)

EMBL: CP001275.PE259

CP001275.PE259       Location/Qualifiers
FT   CDS             268496..269674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05213"
FT                   /db_xref="GOA:B9KXS5"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS5"
FT                   /protein_id="ACM05213.1"
FT                   /translation="MVRRGLGRSFLFVWLAFMLSALPAHAQEGNGAISGRVQNGTAGGG
FT                   PVSSLTVTLRHFAGMQLAEERQTQTGPDGSFRFDGLPTSPQDAYLVVVRYAGVDYVSGM
FT                   VQLHQQPEQTVDLTVYETTTDPSAMRIASRSLVIAGASPELRAVDIMDILIVENSGDRT
FT                   YLGDRSGVVLRIPLPRGAQEISPQPGFDYGQPRLEDGVLLTTGPLPPGSQTVVLSYTVP
FT                   YEGTRATLSIGTAMPTSTLRVLVRDGTYRLSSRSLIDTGTVEVSGVTYRVLAVDAPVVG
FT                   DMHVVQVSGLPRTGLLFDLPTGPIIALVVGLAGLVAAAVLTVIVLRRRRVGTETSRAAI
FT                   DERLQLAAELNRLDEARAAGELDETAYQEQRSAVLARLRQLVAREQGVERSG"
     MVRRGLGRSF LFVWLAFMLS ALPAHAQEGN GAISGRVQNG TAGGGPVSSL TVTLRHFAGM        60
     QLAEERQTQT GPDGSFRFDG LPTSPQDAYL VVVRYAGVDY VSGMVQLHQQ PEQTVDLTVY       120
     ETTTDPSAMR IASRSLVIAG ASPELRAVDI MDILIVENSG DRTYLGDRSG VVLRIPLPRG       180
     AQEISPQPGF DYGQPRLEDG VLLTTGPLPP GSQTVVLSYT VPYEGTRATL SIGTAMPTST       240
     LRVLVRDGTY RLSSRSLIDT GTVEVSGVTY RVLAVDAPVV GDMHVVQVSG LPRTGLLFDL       300
     PTGPIIALVV GLAGLVAAAV LTVIVLRRRR VGTETSRAAI DERLQLAAEL NRLDEARAAG       360
     ELDETAYQEQ RSAVLARLRQ LVAREQGVER SG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page