(data stored in ACNUC30630 zone)

EMBL: CP001275.PE26

CP001275.PE26        Location/Qualifiers
FT   CDS             complement(28233..29576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0027"
FT                   /product="aminotransferase, class I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04951"
FT                   /db_xref="GOA:B9L1C6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C6"
FT                   /protein_id="ACM04951.1"
FT                   /translation="MSAYRELAAAGLISGHVGRGTVVVDPAQHRESRAPAGGVPWPQLF
FT                   APLATALYDPALEDAMIAAARPDVISFATGQPAPECYPIATVRQLLDEALHREGARLLQ
FT                   YCPSEGYPPLREAIASWSQQAGIRCTAENVLVVSGSQQGLYLVARALVEPGDLVAVESP
FT                   TYAGALQIFRAVGARLLPIPVDEFGMRVSLLERALEHRRPKLIYTLPTFQNPSGATLAL
FT                   DRRLHLLDLAARAGIPVVEDDPYRELWYDAPPPPPLAALDQAGTVISLTTVSKILFPGF
FT                   RIGWIIAPWPVIRQLALVKQLVDLDTNPLMQWAIWAFLERRLLPPHLEELRRVHRDRRD
FT                   LLLASLAAEANGALHCRVPAGGLYLWCELADGIRARDLVPEAARQGVAIVPGESFFVDP
FT                   AQGRSFVRLNFTYPAPAALVEGAKRLGRALSALREARALLAQASSPIV"
     MSAYRELAAA GLISGHVGRG TVVVDPAQHR ESRAPAGGVP WPQLFAPLAT ALYDPALEDA        60
     MIAAARPDVI SFATGQPAPE CYPIATVRQL LDEALHREGA RLLQYCPSEG YPPLREAIAS       120
     WSQQAGIRCT AENVLVVSGS QQGLYLVARA LVEPGDLVAV ESPTYAGALQ IFRAVGARLL       180
     PIPVDEFGMR VSLLERALEH RRPKLIYTLP TFQNPSGATL ALDRRLHLLD LAARAGIPVV       240
     EDDPYRELWY DAPPPPPLAA LDQAGTVISL TTVSKILFPG FRIGWIIAPW PVIRQLALVK       300
     QLVDLDTNPL MQWAIWAFLE RRLLPPHLEE LRRVHRDRRD LLLASLAAEA NGALHCRVPA       360
     GGLYLWCELA DGIRARDLVP EAARQGVAIV PGESFFVDPA QGRSFVRLNF TYPAPAALVE       420
     GAKRLGRALS ALREARALLA QASSPIV                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page