(data stored in ACNUC30630 zone)

EMBL: CP001275.PE266

CP001275.PE266       Location/Qualifiers
FT   CDS             278471..278995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04643"
FT                   /db_xref="GOA:B9KXT2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT2"
FT                   /protein_id="ACM04643.1"
FT                   /translation="MGRERTRSDRTLIVRRSRLRGLLIAALALAFFVAAVWFAWHAGSW
FT                   LERLFAVSMAVFLGLVTVVSTLIALDRNPVLEIDEEGLTDRGSPVRAGRVPWQSIRRIE
FT                   AKSVGTRRYLVVQVYRPQRFIADLDPERRKAAEELIQRHGTPIVIPWEALDQPLDAVVE
FT                   QAEALRQSTAT"
     MGRERTRSDR TLIVRRSRLR GLLIAALALA FFVAAVWFAW HAGSWLERLF AVSMAVFLGL        60
     VTVVSTLIAL DRNPVLEIDE EGLTDRGSPV RAGRVPWQSI RRIEAKSVGT RRYLVVQVYR       120
     PQRFIADLDP ERRKAAEELI QRHGTPIVIP WEALDQPLDA VVEQAEALRQ STAT             174
//

If you have problems or comments...

PBIL Back to PBIL home page