(data stored in ACNUC30630 zone)

EMBL: CP001275.PE274

CP001275.PE274       Location/Qualifiers
FT   CDS             complement(285545..285820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06271"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU0"
FT                   /protein_id="ACM06271.1"
FT                   /translation="MAETHPFRLHPDEVARRAREYFTDQLGIPLVRDMAGYMRFEDVHG
FT                   FVELDIRGDANNQSRVTFQYQGYEREVHEFRRLLAEQAQEETRQGE"
     MAETHPFRLH PDEVARRARE YFTDQLGIPL VRDMAGYMRF EDVHGFVELD IRGDANNQSR        60
     VTFQYQGYER EVHEFRRLLA EQAQEETRQG E                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page