(data stored in ACNUC30630 zone)

EMBL: CP001275.PE277

CP001275.PE277       Location/Qualifiers
FT   CDS             complement(286829..288175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0281"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04834"
FT                   /db_xref="GOA:B9KXU3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU3"
FT                   /protein_id="ACM04834.1"
FT                   /translation="MTDCGIDWNALQDEVTRHLQALIRFETVNPPGNETPFAEYLAGVL
FT                   RREGIAAEVVESAPGRGNLVARLRGRGHGRPLLLMAHSDVVSVERDKWTRDPFGGELVD
FT                   GRVWGRGAVDTKGLVACELGVMLTIQRLGLPLERDLIFAVFADEEAGGQYGACWMWEHR
FT                   RDLIDAEFAINEGGGMALTLGGQRFYLCQTGEKGAARLRLTARGQPGHASMPIPDTAMQ
FT                   HAARAILTLSTHTFPTVLTPTVTRFLHEIGRALGGSVRQQIESALADPTWERLAALPLG
FT                   PGERRLLYAMTRNTAVPTIVRGGHRINVIPSEVVVEVDGRILPGQEPEAFAAEVQRLVG
FT                   PHVEVELTTRGRGLEADPDSPLFRTISETMAELDPGARVVPYLIPGGTDAKCLPGITVY
FT                   GFMPMRDHPEEFELAHAHDERISVSTLGFATRALFEIVTRFCAPRSRSR"
     MTDCGIDWNA LQDEVTRHLQ ALIRFETVNP PGNETPFAEY LAGVLRREGI AAEVVESAPG        60
     RGNLVARLRG RGHGRPLLLM AHSDVVSVER DKWTRDPFGG ELVDGRVWGR GAVDTKGLVA       120
     CELGVMLTIQ RLGLPLERDL IFAVFADEEA GGQYGACWMW EHRRDLIDAE FAINEGGGMA       180
     LTLGGQRFYL CQTGEKGAAR LRLTARGQPG HASMPIPDTA MQHAARAILT LSTHTFPTVL       240
     TPTVTRFLHE IGRALGGSVR QQIESALADP TWERLAALPL GPGERRLLYA MTRNTAVPTI       300
     VRGGHRINVI PSEVVVEVDG RILPGQEPEA FAAEVQRLVG PHVEVELTTR GRGLEADPDS       360
     PLFRTISETM AELDPGARVV PYLIPGGTDA KCLPGITVYG FMPMRDHPEE FELAHAHDER       420
     ISVSTLGFAT RALFEIVTRF CAPRSRSR                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page