(data stored in ACNUC30630 zone)

EMBL: CP001275.PE278

CP001275.PE278       Location/Qualifiers
FT   CDS             complement(288172..289101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0282"
FT                   /product="putative integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06244"
FT                   /db_xref="GOA:B9KXU4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU4"
FT                   /protein_id="ACM06244.1"
FT                   /translation="MTAGWRARVERRWLVGIDRIGAGAVVLSALGFGTLATLTKLAYGA
FT                   SVPVPTLIAWRFGIAALLVIMALPLEQWRRGQLFGRQPWTDRRRLATAAAVACFVGNTI
FT                   LYLVALQRVSVATAAILFYVYPLVVLALRLVGWREVPTRRQLAALLAGFSGVTLTLGWR
FT                   WHTIDLTGSLLMLASASLYAAYIVFGHRGFRDASPVLATACTFSATAVVALALLSVERA
FT                   PLLIDRSALLPVLGIVVLATVLPVQLFLIGTLRLGPTPAAILGTLEPVASVFVAMMVLS
FT                   EQLTLVQLVGGLLVLTAAAVISGQGGKP"
     MTAGWRARVE RRWLVGIDRI GAGAVVLSAL GFGTLATLTK LAYGASVPVP TLIAWRFGIA        60
     ALLVIMALPL EQWRRGQLFG RQPWTDRRRL ATAAAVACFV GNTILYLVAL QRVSVATAAI       120
     LFYVYPLVVL ALRLVGWREV PTRRQLAALL AGFSGVTLTL GWRWHTIDLT GSLLMLASAS       180
     LYAAYIVFGH RGFRDASPVL ATACTFSATA VVALALLSVE RAPLLIDRSA LLPVLGIVVL       240
     ATVLPVQLFL IGTLRLGPTP AAILGTLEPV ASVFVAMMVL SEQLTLVQLV GGLLVLTAAA       300
     VISGQGGKP                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page