(data stored in ACNUC30630 zone)

EMBL: CP001275.PE290

CP001275.PE290       Location/Qualifiers
FT   CDS             complement(301208..302023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0297"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04507"
FT                   /db_xref="GOA:B9KXV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV6"
FT                   /protein_id="ACM04507.1"
FT                   /translation="MGRLTGLVALVTGAGGGEMGGGGAGIARVLAREGAIVAVNDLHED
FT                   YARATVDQITRNGGQSFALAGDVSDPRQANELVSSVIARCGRLDILVNDAARLGRTPAV
FT                   ERMSDEEWHSYIAVNLSGPFYMSRAAIPHMMQREYGRIINIASLAALRASLNGGAGYTS
FT                   SKRGLLGLTRQLAAEFYTYNITVNAVLPAGILSGRLRAEMGEHAEALVATRRWALPDDI
FT                   GQICAYLASPEAHLISASVIVVPGVNATGLGDFAQYRAMARQIGKDIGE"
     MGRLTGLVAL VTGAGGGEMG GGGAGIARVL AREGAIVAVN DLHEDYARAT VDQITRNGGQ        60
     SFALAGDVSD PRQANELVSS VIARCGRLDI LVNDAARLGR TPAVERMSDE EWHSYIAVNL       120
     SGPFYMSRAA IPHMMQREYG RIINIASLAA LRASLNGGAG YTSSKRGLLG LTRQLAAEFY       180
     TYNITVNAVL PAGILSGRLR AEMGEHAEAL VATRRWALPD DIGQICAYLA SPEAHLISAS       240
     VIVVPGVNAT GLGDFAQYRA MARQIGKDIG E                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page