(data stored in ACNUC30630 zone)

EMBL: CP001275.PE299

CP001275.PE299       Location/Qualifiers
FT   CDS             312107..313069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0307"
FT                   /product="putative aromatic metabolite ABC transporter"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05763"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW5"
FT                   /protein_id="ACM05763.1"
FT                   /translation="MPEREILGIHHVTAVTGRATENVRFYTRVLGLRLVKKTVNQDDVS
FT                   AYHLFYADAVGSPGTDVTFFDWPNLPPHRSGSGEIARIALRVDNAAALEWWVEWLQQHG
FT                   VPGVEWGNYAGRQAVFFRDFEGQRLALVDDGGTVGGTPRDRSPVPPAYQIKGIFAVSLV
FT                   VRSLEPTARVLTEVLGFRLRQEERSHARTALFEVGPGGPGALIVVEERPDQPRAQLGTG
FT                   GVHHVAFRVSDDAAHQAWRARIAQAGIPVTPQIDRFYFRSLYFREPGGILFELATDGPG
FT                   FAIDEDLEHLGERLSLPPFLEPRRAEIEANLRPLEPIEA"
     MPEREILGIH HVTAVTGRAT ENVRFYTRVL GLRLVKKTVN QDDVSAYHLF YADAVGSPGT        60
     DVTFFDWPNL PPHRSGSGEI ARIALRVDNA AALEWWVEWL QQHGVPGVEW GNYAGRQAVF       120
     FRDFEGQRLA LVDDGGTVGG TPRDRSPVPP AYQIKGIFAV SLVVRSLEPT ARVLTEVLGF       180
     RLRQEERSHA RTALFEVGPG GPGALIVVEE RPDQPRAQLG TGGVHHVAFR VSDDAAHQAW       240
     RARIAQAGIP VTPQIDRFYF RSLYFREPGG ILFELATDGP GFAIDEDLEH LGERLSLPPF       300
     LEPRRAEIEA NLRPLEPIEA                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page