(data stored in ACNUC30630 zone)

EMBL: CP001275.PE30

CP001275.PE30        Location/Qualifiers
FT   CDS             38388..39326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0032"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06170"
FT                   /db_xref="GOA:B9L250"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B9L250"
FT                   /protein_id="ACM06170.1"
FT                   /translation="MDGRLQIFAGNSNPRLAQAIVGVLETPLGRAEVSSWSDGETRVRL
FT                   EENVRGSDVFVIQSLCTPVNQNIMELLIILDAVKRASAARITAVIPYYAYARQEKKTAG
FT                   REPISAKLLANLLTTAGADRVLTIDLHAPAIEGFFDIPVDHLRATPILAAHFRRLGLTD
FT                   FVVVSPDAGAVVRADEFRRRAGGSLAIISKKRPGPEVAEVLEMVGDVAGRDAVIVDDII
FT                   ATGGTLLQAAELLRERGARRIFAAAVHGVFAGQALERIQASPIEKVFVTDTIPLPEGMC
FT                   TDKVEVLTVAPLLAEAIMRIHKDLSISALFT"
     MDGRLQIFAG NSNPRLAQAI VGVLETPLGR AEVSSWSDGE TRVRLEENVR GSDVFVIQSL        60
     CTPVNQNIME LLIILDAVKR ASAARITAVI PYYAYARQEK KTAGREPISA KLLANLLTTA       120
     GADRVLTIDL HAPAIEGFFD IPVDHLRATP ILAAHFRRLG LTDFVVVSPD AGAVVRADEF       180
     RRRAGGSLAI ISKKRPGPEV AEVLEMVGDV AGRDAVIVDD IIATGGTLLQ AAELLRERGA       240
     RRIFAAAVHG VFAGQALERI QASPIEKVFV TDTIPLPEGM CTDKVEVLTV APLLAEAIMR       300
     IHKDLSISAL FT                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page