(data stored in ACNUC30630 zone)

EMBL: CP001275.PE31

CP001275.PE31        Location/Qualifiers
FT   CDS             39368..40630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0033"
FT                   /product="magnesium and cobalt efflux protein corC"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05818"
FT                   /db_xref="GOA:B9L251"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9L251"
FT                   /protein_id="ACM05818.1"
FT                   /translation="MSSPWTEAILFVVLAALFFAAALADLASCLPARRSLREFLAELAE
FT                   TQNGNGENTLEQLRVARPAIRLVQATTFLGLTVLALRIGHRWWPKHELAVAVLIAFVAL
FT                   LVLASAAPMALLERRYPLTSARFRLLAGLLSRLGAPLRVLSELLERPLAALIPPAPAPA
FT                   VPSAAAPPAHEEVVEEAEELIERVLRLDRLTARDIMVPRTDIVAVPFELSVRDAIAVAR
FT                   QTRHSRLPVYQGTIDRIVGIVHVRDLLRFALESAEGIKVGDVMREAYFIPESKRVDELL
FT                   RDLQHQRVHMAIVVDEFGGTAGIVTIEDVLEEIVGEIQDEYDAEAPLVERLSADEAIVD
FT                   GRISLEEIADIFGVSLEEEESSTIGGLVQAHLGRIPQPGESVRVDGLEVTVLEVAGNRV
FT                   RKLSVRRVAASVSASDEDERS"
     MSSPWTEAIL FVVLAALFFA AALADLASCL PARRSLREFL AELAETQNGN GENTLEQLRV        60
     ARPAIRLVQA TTFLGLTVLA LRIGHRWWPK HELAVAVLIA FVALLVLASA APMALLERRY       120
     PLTSARFRLL AGLLSRLGAP LRVLSELLER PLAALIPPAP APAVPSAAAP PAHEEVVEEA       180
     EELIERVLRL DRLTARDIMV PRTDIVAVPF ELSVRDAIAV ARQTRHSRLP VYQGTIDRIV       240
     GIVHVRDLLR FALESAEGIK VGDVMREAYF IPESKRVDEL LRDLQHQRVH MAIVVDEFGG       300
     TAGIVTIEDV LEEIVGEIQD EYDAEAPLVE RLSADEAIVD GRISLEEIAD IFGVSLEEEE       360
     SSTIGGLVQA HLGRIPQPGE SVRVDGLEVT VLEVAGNRVR KLSVRRVAAS VSASDEDERS       420
//

If you have problems or comments...

PBIL Back to PBIL home page