(data stored in ACNUC30630 zone)

EMBL: CP001275.PE310

CP001275.PE310       Location/Qualifiers
FT   CDS             324046..324879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0318"
FT                   /product="putative ABC transport proteins, inner membrane
FT                   component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05895"
FT                   /db_xref="GOA:B9KXX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX6"
FT                   /protein_id="ACM05895.1"
FT                   /translation="MMVEGGASVERTTMQRGRWLPQAGVKTEAAIQLLSPVALLALWEA
FT                   AARAGWVDQRFFPAPSTIVGAFWDAITTGVLLHHLKITLWRVLLGTVIGGVPAVLIGLA
FT                   MGMWRWLRLTLDPIIAATYPLPKSALFPLLLLIFGLGEGSKVSMVAIGVFYLAVTNAME
FT                   GVLAINPVYFDVAKTFGARRWDVIRTVALPGAMPLVLAGLRLGVGTGLILGVLAEMLGA
FT                   RDGLGYLLWSAWQTFSVSLLWATLFVTAILGFASVQLVDFLRRVLVPWQRGTARR"
     MMVEGGASVE RTTMQRGRWL PQAGVKTEAA IQLLSPVALL ALWEAAARAG WVDQRFFPAP        60
     STIVGAFWDA ITTGVLLHHL KITLWRVLLG TVIGGVPAVL IGLAMGMWRW LRLTLDPIIA       120
     ATYPLPKSAL FPLLLLIFGL GEGSKVSMVA IGVFYLAVTN AMEGVLAINP VYFDVAKTFG       180
     ARRWDVIRTV ALPGAMPLVL AGLRLGVGTG LILGVLAEML GARDGLGYLL WSAWQTFSVS       240
     LLWATLFVTA ILGFASVQLV DFLRRVLVPW QRGTARR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page