(data stored in ACNUC30630 zone)

EMBL: CP001275.PE319

CP001275.PE319       Location/Qualifiers
FT   CDS             complement(329757..330116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0327"
FT                   /product="putative membrane protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05857"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY5"
FT                   /protein_id="ACM05857.1"
FT                   /translation="MISLCHPIRRYPVAFWQVTWLARIEAARAAQLLRDHYPAVFGRAR
FT                   LRRLGYPGIRQTRTIVGEYMLTVEDVLAGRRFPDAIARVAWPIELLTQRRATIGSHSRT
FT                   VTFTPSPIAPCSHPS"
     MISLCHPIRR YPVAFWQVTW LARIEAARAA QLLRDHYPAV FGRARLRRLG YPGIRQTRTI        60
     VGEYMLTVED VLAGRRFPDA IARVAWPIEL LTQRRATIGS HSRTVTFTPS PIAPCSHPS        119
//

If you have problems or comments...

PBIL Back to PBIL home page