(data stored in ACNUC30630 zone)

EMBL: CP001275.PE352

CP001275.PE352       Location/Qualifiers
FT   CDS             362492..363154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05292"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY18"
FT                   /protein_id="ACM05292.1"
FT                   /translation="MTFDVTWYAQSAFRIDVAGLRLYHDPFQIPDGEPTADVILISHEH
FT                   FDHCSPPDIARIRDVHKTFVVANPTAANTRELEPPVHVIRPGGEVQYGRLSIRAVPAYN
FT                   LNKFRSPGVPFHPREKEHVGFICRAEGVTWYFAGDTDAIPEMAQFGPVDYAFLPVSGTY
FT                   VMTAEEAAEAVRMLQPRVVIPMHYGTVVGSVEDARRLAALVGDVAEVRILEPRGRPS"
     MTFDVTWYAQ SAFRIDVAGL RLYHDPFQIP DGEPTADVIL ISHEHFDHCS PPDIARIRDV        60
     HKTFVVANPT AANTRELEPP VHVIRPGGEV QYGRLSIRAV PAYNLNKFRS PGVPFHPREK       120
     EHVGFICRAE GVTWYFAGDT DAIPEMAQFG PVDYAFLPVS GTYVMTAEEA AEAVRMLQPR       180
     VVIPMHYGTV VGSVEDARRL AALVGDVAEV RILEPRGRPS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page