(data stored in ACNUC30630 zone)

EMBL: CP001275.PE354

CP001275.PE354       Location/Qualifiers
FT   CDS             364325..365935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0363"
FT                   /product="probable acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04855"
FT                   /db_xref="GOA:B9KY20"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY20"
FT                   /protein_id="ACM04855.1"
FT                   /translation="MRVTGGEAVVRTLERLGVEVVFGIPGVHTLAIYDALYSSPIRHVL
FT                   ARHEQGAGFMADGYARVSGKPGVAIVITGPGVTNIATAIGEAYADSSPVVVIASNVEQA
FT                   WQGQMLGHLHDCKDQLGIMRVVTKWADRARSVEDVPRLLRTAFAEAISGRRRPTHLEVP
FT                   LDVLHGSGDIELAHLAPLSMERSQPRRSAIELAARMIEEAERVVLYCGGGVVASGATAE
FT                   LSALAERLGAAVITSLQGKGAIPEDHPRCLGNLWEPENAVERVLRESDLVIVIGSKLGA
FT                   QDTANGRLPLPDRRIRIDIDAQEILRNYPPTLPIVADARETVRALLSELTSRGITKQGW
FT                   PVDVLQATKREALATAWGAGQAEWLRAIRAVLPRDGILVSDMTMMAYVGNRHYPVYEPG
FT                   TYLFPTGYGTLGFALPAAIGAKIARPEAAVVALVGDGGYQFTMQELATAVQFRIGIPII
FT                   LFNDASYTAVKDEQARSFGGRFIAVDLVNPDFQKLAAAYGIPSEYVTSPQTLEGAIARA
FT                   LERDLPTLIEVPIDFPLGA"
     MRVTGGEAVV RTLERLGVEV VFGIPGVHTL AIYDALYSSP IRHVLARHEQ GAGFMADGYA        60
     RVSGKPGVAI VITGPGVTNI ATAIGEAYAD SSPVVVIASN VEQAWQGQML GHLHDCKDQL       120
     GIMRVVTKWA DRARSVEDVP RLLRTAFAEA ISGRRRPTHL EVPLDVLHGS GDIELAHLAP       180
     LSMERSQPRR SAIELAARMI EEAERVVLYC GGGVVASGAT AELSALAERL GAAVITSLQG       240
     KGAIPEDHPR CLGNLWEPEN AVERVLRESD LVIVIGSKLG AQDTANGRLP LPDRRIRIDI       300
     DAQEILRNYP PTLPIVADAR ETVRALLSEL TSRGITKQGW PVDVLQATKR EALATAWGAG       360
     QAEWLRAIRA VLPRDGILVS DMTMMAYVGN RHYPVYEPGT YLFPTGYGTL GFALPAAIGA       420
     KIARPEAAVV ALVGDGGYQF TMQELATAVQ FRIGIPIILF NDASYTAVKD EQARSFGGRF       480
     IAVDLVNPDF QKLAAAYGIP SEYVTSPQTL EGAIARALER DLPTLIEVPI DFPLGA           536
//

If you have problems or comments...

PBIL Back to PBIL home page