(data stored in ACNUC30630 zone)

EMBL: CP001275.PE363

CP001275.PE363       Location/Qualifiers
FT   CDS             376818..376940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04680"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY29"
FT                   /protein_id="ACM04680.1"
FT                   /translation="MCHRCPPLWSSQLWSVAKSWRCRSWTDRRSDRSTATHAGR"
     MCHRCPPLWS SQLWSVAKSW RCRSWTDRRS DRSTATHAGR                              40
//

If you have problems or comments...

PBIL Back to PBIL home page